Lineage for d1skt__ (1skt -)
- Root: SCOP 1.57
Class a: All alpha proteins [46456] (144 folds) Fold a.39: EF Hand-like [47472] (3 superfamilies) Superfamily a.39.1: EF-hand [47473] (8 families) 
Family a.39.1.5: Calmodulin-like [47502] (15 proteins) 
Protein Troponin C [47503] (5 species) Species Chicken (Gallus gallus) [TaxId:9031] [47504] (22 PDB entries) 
Domain d1skt__: 1skt - [17243]
Details for d1skt__
PDB Entry: 1skt (more details)
PDB Description: solution structure of apo n-domain of troponin c, nmr, 40 structures
SCOP Domain Sequences for d1skt__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1skt__ a.39.1.5 (-) Troponin C {Chicken (Gallus gallus)}
asmtdqqaearaflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeelda
iieevdedgsgtidfeeflvmmvrqmkeda
SCOP Domain Coordinates for d1skt__:
Click to download the PDB-style file with coordinates for d1skt__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1skt__:
- d1skt__ first appeared (with stable ids) in SCOP 1.55
- d1skt__ appears in SCOP 1.59
- d1skt__ appears in the current release, SCOPe 2.08, called d1skta_
View in 3D