Lineage for d3b4xa_ (3b4x A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2004934Protein Cyp119 [48278] (3 species)
    thermophilic P450
  7. 2004952Species Sulfolobus tokodaii [TaxId:111955] [109957] (2 PDB entries)
    Uniprot Q972I2
  8. 2004953Domain d3b4xa_: 3b4x A: [172427]
    automated match to d1ue8a_
    complexed with hem

Details for d3b4xa_

PDB Entry: 3b4x (more details), 1.94 Å

PDB Description: Crystal Structure Analysis of Sulfolobus tokodaii strain7 cytochrom P450
PDB Compounds: (A:) 367aa long hypothetical cytochrome P450

SCOPe Domain Sequences for d3b4xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b4xa_ a.104.1.1 (A:) Cyp119 {Sulfolobus tokodaii [TaxId: 111955]}
mydwfkqmrkespvyydgkvwnlfkyedckmvlndhkrfssnltgyndklemlrsgkvff
diptrytmltsdpplhdelrnltadafnpsnlpvdfvrevtvkllseldeefdviesfai
plpilviskmlginpdvkkvkdwsdlvalrlgradeifsigrkylelisfskkeldsrkg
keivdltgkiansnlselekegyfillmiagnetttnlignaiedftlynswdyvrekga
lkaveealrfsppvmrtirvtkekvkirdqvidegelvrvwiasanrdeevfkdpdsfip
drtpnphlsfgsgihlclgaplarlearialeefakkfrvkeivkkekidnevlngyrkl
vvrvert

SCOPe Domain Coordinates for d3b4xa_:

Click to download the PDB-style file with coordinates for d3b4xa_.
(The format of our PDB-style files is described here.)

Timeline for d3b4xa_: