Lineage for d3b4ub_ (3b4u B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2443024Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2444581Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2444582Protein automated matches [190115] (91 species)
    not a true protein
  7. 2444631Species Agrobacterium tumefaciens [TaxId:176299] [188284] (2 PDB entries)
  8. 2444633Domain d3b4ub_: 3b4u B: [172426]
    automated match to d1xkya1
    complexed with mg

Details for d3b4ub_

PDB Entry: 3b4u (more details), 1.2 Å

PDB Description: Crystal structure of dihydrodipicolinate synthase from Agrobacterium tumefaciens str. C58
PDB Compounds: (B:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d3b4ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b4ub_ c.1.10.0 (B:) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
qkfglsaalttpfktdgtvdidamiaharrclsngcdsvtlfgttgegcsvgsrerqail
ssfiaagiapsrivtgvlvdsiedaadqsaealnagarnillappsyfknvsddglfawf
savfskigkdardilvynipsvtmvtlsvelvgrlkaafpgivtgvkdssgnwshterll
kehgdlailigderdlargvrlggqgaisgvanfltqevramavdgkddprivdlvvell
kfpvtpavkvlvshttgetiwsdvraplvaispedrrqiegafdalfr

SCOPe Domain Coordinates for d3b4ub_:

Click to download the PDB-style file with coordinates for d3b4ub_.
(The format of our PDB-style files is described here.)

Timeline for d3b4ub_: