Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
Protein automated matches [190115] (91 species) not a true protein |
Species Agrobacterium tumefaciens [TaxId:176299] [188284] (2 PDB entries) |
Domain d3b4ub_: 3b4u B: [172426] automated match to d1xkya1 complexed with mg |
PDB Entry: 3b4u (more details), 1.2 Å
SCOPe Domain Sequences for d3b4ub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b4ub_ c.1.10.0 (B:) automated matches {Agrobacterium tumefaciens [TaxId: 176299]} qkfglsaalttpfktdgtvdidamiaharrclsngcdsvtlfgttgegcsvgsrerqail ssfiaagiapsrivtgvlvdsiedaadqsaealnagarnillappsyfknvsddglfawf savfskigkdardilvynipsvtmvtlsvelvgrlkaafpgivtgvkdssgnwshterll kehgdlailigderdlargvrlggqgaisgvanfltqevramavdgkddprivdlvvell kfpvtpavkvlvshttgetiwsdvraplvaispedrrqiegafdalfr
Timeline for d3b4ub_: