SCOPe 2.08: Domain d3b4ua_: 3b4u A:

Lineage for d3b4ua_ (3b4u A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.0: automated matches [191319] (1 protein)
   not a true family

6. Protein automated matches [190115] (94 species)
   not a true protein

7. Species Agrobacterium tumefaciens [TaxId:176299] [188284] (2 PDB entries)

8. Domain d3b4ua_: 3b4u A: [172425]
   automated match to d1xkya1
   complexed with mg

Details for d3b4ua_

PDB Entry: 3b4u, 1.2 Å

PDB Description: Crystal structure of dihydrodipicolinate synthase from Agrobacterium tumefaciens str. C58

PDB Compounds: (A:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d3b4ua_:

Sequence; same for both SEQRES and ATOM records:

>d3b4ua_ c.1.10.0 (A:) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
kfglsaalttpfktdgtvdidamiaharrclsngcdsvtlfgttgegcsvgsrerqails
sfiaagiapsrivtgvlvdsiedaadqsaealnagarnillappsyfknvsddglfawfs
avfskigkdardilvynipsvtmvtlsvelvgrlkaafpgivtgvkdssgnwshterllk
ehgdlailigderdlargvrlggqgaisgvanfltqevramavdgkddprivdlvvellk
fpvtpavkvlvshttgetiwsdvraplvaispedrrqiegafdalfr

Timeline for d3b4ua_:

• d3b4ua_ first appeared in SCOPe 2.01
  
• d3b4ua_ appears in SCOPe 2.07