Lineage for d3b4ua_ (3b4u A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2835965Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2835966Protein automated matches [190115] (94 species)
    not a true protein
  7. 2836015Species Agrobacterium tumefaciens [TaxId:176299] [188284] (2 PDB entries)
  8. 2836016Domain d3b4ua_: 3b4u A: [172425]
    automated match to d1xkya1
    complexed with mg

Details for d3b4ua_

PDB Entry: 3b4u (more details), 1.2 Å

PDB Description: Crystal structure of dihydrodipicolinate synthase from Agrobacterium tumefaciens str. C58
PDB Compounds: (A:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d3b4ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b4ua_ c.1.10.0 (A:) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
kfglsaalttpfktdgtvdidamiaharrclsngcdsvtlfgttgegcsvgsrerqails
sfiaagiapsrivtgvlvdsiedaadqsaealnagarnillappsyfknvsddglfawfs
avfskigkdardilvynipsvtmvtlsvelvgrlkaafpgivtgvkdssgnwshterllk
ehgdlailigderdlargvrlggqgaisgvanfltqevramavdgkddprivdlvvellk
fpvtpavkvlvshttgetiwsdvraplvaispedrrqiegafdalfr

SCOPe Domain Coordinates for d3b4ua_:

Click to download the PDB-style file with coordinates for d3b4ua_.
(The format of our PDB-style files is described here.)

Timeline for d3b4ua_: