Lineage for d2ctna_ (2ctn A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1489461Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1489462Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1489858Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 1490325Protein Troponin C [47503] (6 species)
  7. 1490326Species Chicken (Gallus gallus) [TaxId:9031] [47504] (28 PDB entries)
    Uniprot P09860
  8. 1490352Domain d2ctna_: 2ctn A: [17242]
    N-domain only; C-terminal domain is in 3CTN
    complexed with ca

Details for d2ctna_

PDB Entry: 2ctn (more details)

PDB Description: structure of calcium-saturated cardiac troponin c, nmr, 30 structures
PDB Compounds: (A:) troponin c

SCOPe Domain Sequences for d2ctna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ctna_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}
adiykaaveqlteeqknefkaafdifvlgaedgsistkelgkvmrmlgqnptpeelqemi
devdedgsgtvdfdeflvmmvrsmkdds

SCOPe Domain Coordinates for d2ctna_:

Click to download the PDB-style file with coordinates for d2ctna_.
(The format of our PDB-style files is described here.)

Timeline for d2ctna_: