Lineage for d2ctn__ (2ctn -)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 537532Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 537533Superfamily a.39.1: EF-hand [47473] (10 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 537713Family a.39.1.5: Calmodulin-like [47502] (23 proteins)
    Duplication: made with two pairs of EF-hands
  6. 537965Protein Troponin C [47503] (6 species)
  7. 537966Species Chicken (Gallus gallus) [TaxId:9031] [47504] (26 PDB entries)
  8. 537993Domain d2ctn__: 2ctn - [17242]
    N-domain only; C-terminal domain is in 3CTN
    complexed with ca; mutant

Details for d2ctn__

PDB Entry: 2ctn (more details)

PDB Description: structure of calcium-saturated cardiac troponin c, nmr, 30 structures

SCOP Domain Sequences for d2ctn__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ctn__ a.39.1.5 (-) Troponin C {Chicken (Gallus gallus)}
adiykaaveqlteeqknefkaafdifvlgaedgsistkelgkvmrmlgqnptpeelqemi
devdedgsgtvdfdeflvmmvrsmkdds

SCOP Domain Coordinates for d2ctn__:

Click to download the PDB-style file with coordinates for d2ctn__.
(The format of our PDB-style files is described here.)

Timeline for d2ctn__: