Lineage for d3b3kb_ (3b3k B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2011944Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2011945Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2011946Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2012438Protein Peroxisome proliferator activated receptor gamma, PPAR-gamma [48524] (1 species)
  7. 2012439Species Human (Homo sapiens) [TaxId:9606] [48525] (113 PDB entries)
    Uniprot P37231 232-505
  8. 2012589Domain d3b3kb_: 3b3k B: [172413]
    automated match to d1nyxa_
    protein/DNA complex; complexed with lrg

Details for d3b3kb_

PDB Entry: 3b3k (more details), 2.6 Å

PDB Description: Crystal structure of the complex between PPARgamma and the full agonist LT175
PDB Compounds: (B:) Peroxisome proliferator-activated receptor gamma

SCOPe Domain Sequences for d3b3kb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b3kb_ a.123.1.1 (B:) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii
ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai
fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv
tehvqllqvikktetdmslhpllqeiykdl

SCOPe Domain Coordinates for d3b3kb_:

Click to download the PDB-style file with coordinates for d3b3kb_.
(The format of our PDB-style files is described here.)

Timeline for d3b3kb_: