SCOPe 2.04: Domain d3ctna_: 3ctn A:

Lineage for d3ctna_ (3ctn A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Troponin C [47503] (6 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [47504] (28 PDB entries)
   Uniprot P09860

8. Domain d3ctna_: 3ctn A: [17241]
   C-domain only; N-terminal domain is in 2CTN
   complexed with ca

Details for d3ctna_

PDB Entry: 3ctn

PDB Description: structure of calcium-saturated cardiac troponin c, nmr, 30 structures

PDB Compounds: (A:) troponin c

SCOPe Domain Sequences for d3ctna_:

Sequence; same for both SEQRES and ATOM records:

>d3ctna_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}
kddskgkteeelsdlfrmfdknadgyidleelkimlqatgetiteddieelmkdgdknnd
gridydeflefmkgve

Timeline for d3ctna_:

• d3ctna_ first appeared (with stable ids) in SCOP 1.55, called d3ctn__
  
• d3ctna_ appears in SCOPe 2.03
  
• d3ctna_ appears in SCOPe 2.05
  
• d3ctna_ appears in the current release, SCOPe 2.08