SCOPe 2.08: Domain d3b0fb_: 3b0f B:

Lineage for d3b0fb_ (3b0f B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
   3 helices; bundle, right-handed twist

4. Superfamily a.5.2: UBA-like [46934] (5 families)

5. Family a.5.2.1: UBA domain [46935] (25 proteins)

6. Protein automated matches [190533] (3 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [190002] (3 PDB entries)

8. Domain d3b0fb_: 3b0f B: [172402]
   automated match to d1q02a_
   complexed with so4

Details for d3b0fb_

PDB Entry: 3b0f, 1.4 Å

PDB Description: crystal structure of the uba domain of p62 and its interaction with ubiquitin

PDB Compounds: (B:) Sequestosome-1

SCOPe Domain Sequences for d3b0fb_:

Sequence; same for both SEQRES and ATOM records:

>d3b0fb_ a.5.2.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dprlieslsqmlsmgfsdeggwltrllqtknydigaaldtiqy

Timeline for d3b0fb_:

• d3b0fb_ first appeared in SCOPe 2.01
  
• d3b0fb_ appears in SCOPe 2.07