![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies) 3 helices; bundle, right-handed twist |
![]() | Superfamily a.5.2: UBA-like [46934] (5 families) ![]() |
![]() | Family a.5.2.1: UBA domain [46935] (25 proteins) |
![]() | Protein automated matches [190533] (3 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [190002] (3 PDB entries) |
![]() | Domain d3b0fa_: 3b0f A: [172401] automated match to d1q02a_ complexed with so4 |
PDB Entry: 3b0f (more details), 1.4 Å
SCOPe Domain Sequences for d3b0fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b0fa_ a.5.2.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} dprlieslsqmlsmgfsdeggwltrllqtknydigaaldtiqy
Timeline for d3b0fa_: