Lineage for d3b0fa_ (3b0f A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696009Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 2696033Superfamily a.5.2: UBA-like [46934] (5 families) (S)
  5. 2696034Family a.5.2.1: UBA domain [46935] (25 proteins)
  6. 2696138Protein automated matches [190533] (3 species)
    not a true protein
  7. 2696172Species Mouse (Mus musculus) [TaxId:10090] [190002] (3 PDB entries)
  8. 2696173Domain d3b0fa_: 3b0f A: [172401]
    automated match to d1q02a_
    complexed with so4

Details for d3b0fa_

PDB Entry: 3b0f (more details), 1.4 Å

PDB Description: crystal structure of the uba domain of p62 and its interaction with ubiquitin
PDB Compounds: (A:) Sequestosome-1

SCOPe Domain Sequences for d3b0fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b0fa_ a.5.2.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dprlieslsqmlsmgfsdeggwltrllqtknydigaaldtiqy

SCOPe Domain Coordinates for d3b0fa_:

Click to download the PDB-style file with coordinates for d3b0fa_.
(The format of our PDB-style files is described here.)

Timeline for d3b0fa_: