SCOP 1.69: Domain d1blq__: 1blq -

Lineage for d1blq__ (1blq -)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (10 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (23 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Troponin C [47503] (6 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [47504] (24 PDB entries)

8. Domain d1blq__: 1blq - [17240]
   N-domain only

Details for d1blq__

PDB Entry: 1blq

PDB Description: structure and interaction site of the regulatory domain of troponin-c when complexed with the 96-148 region of troponin-i, nmr, 29 structures

SCOP Domain Sequences for d1blq__:

Sequence; same for both SEQRES and ATOM records:

>d1blq__ a.39.1.5 (-) Troponin C {Chicken (Gallus gallus)}
asmtdqqaearaflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeelda
iieevdedgsgtidfeeflvmmvrqmkeda

Timeline for d1blq__:

• d1blq__ first appeared (with stable ids) in SCOP 1.55
  
• d1blq__ appears in SCOP 1.67
  
• d1blq__ appears in SCOP 1.71
  
• d1blq__ appears in the current release, SCOPe 2.08, called d1blqa_