Lineage for d3az3a_ (3az3 A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 923257Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 923258Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 923259Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 923962Protein Vitamin D nuclear receptor [48528] (2 species)
  7. 923963Species Human (Homo sapiens) [TaxId:9606] [48529] (14 PDB entries)
  8. 923964Domain d3az3a_: 3az3 A: [172392]
    automated match to d1db1a_
    complexed with ds6

Details for d3az3a_

PDB Entry: 3az3 (more details), 1.36 Å

PDB Description: crystal structure analysis of vitamin d receptor
PDB Compounds: (A:) Vitamin D3 receptor

SCOPe Domain Sequences for d3az3a_:

Sequence, based on SEQRES records: (download)

>d3az3a_ a.123.1.1 (A:) Vitamin D nuclear receptor {Human (Homo sapiens) [TaxId: 9606]}
lrpklseeqqriiailldahhktydptysdfcqfrppvrvndgggsvtlelsqlsmlphl
adlvsysiqkvigfakmipgfrdltsedqivllkssaievimlrsnesftmddmswtcgn
qdykyrvsdvtkaghslelieplikfqvglkklnlheeehvllmaicivspdrpgvqdaa
lieaiqdrlsntlqtyircrhpppgshllyakmiqkladlrslneehskqyrclsfqpec
smkltplvlevfg

Sequence, based on observed residues (ATOM records): (download)

>d3az3a_ a.123.1.1 (A:) Vitamin D nuclear receptor {Human (Homo sapiens) [TaxId: 9606]}
lrpklseeqqriiailldahhktydptysdfcqfrppvrvndgggsvtlelsqlsmlphl
adlvsysiqkvigfakmipgfrdltsedqivllkssaievimlrsnesftmddmswtcgn
qdykyrvsdvtkaghslelieplikfqvglkklnlheeehvllmaicivspdrpgvqdaa
lieaiqdrlsntlqtyircrhpppllyakmiqkladlrslneehskqyrclsfqpecsmk
ltplvlevfg

SCOPe Domain Coordinates for d3az3a_:

Click to download the PDB-style file with coordinates for d3az3a_.
(The format of our PDB-style files is described here.)

Timeline for d3az3a_: