Lineage for d3ayyd_ (3ayy D:)

  1. Root: SCOPe 2.01
  2. 1054197Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1056951Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
    2 domains: (1) alpa/beta; (2) Fe-S cluster-bound
  4. 1056952Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) (S)
  5. 1057019Family e.19.1.0: automated matches [191636] (1 protein)
    not a true family
  6. 1057020Protein automated matches [191172] (2 species)
    not a true protein
  7. 1057026Species Hydrogenovibrio marinus [TaxId:28885] [189746] (3 PDB entries)
  8. 1057032Domain d3ayyd_: 3ayy D: [172387]
    automated match to d1yq9a1
    complexed with 3ni, cmo, cyn, f3s, fe2, gol, mg, o, sf3, sf4

Details for d3ayyd_

PDB Entry: 3ayy (more details), 1.32 Å

PDB Description: membrane-bound respiratory [nife] hydrogenase from hydrogenovibrio marinus in a ferricyanide-oxidized condition
PDB Compounds: (D:) Membrane-bound hydrogenase small subunit

SCOPe Domain Sequences for d3ayyd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ayyd_ e.19.1.0 (D:) automated matches {Hydrogenovibrio marinus [TaxId: 28885]}
prtpviwlhglectccsesfirsahplakdvvlsmisldyddtlmaasghaaeaildeik
ekykgnyilavegnpplnqdgmsciiggrpfseqlkrmaddakaiiswgscaswgcvqaa
kpnptqatpvhkflgggydkpiikvpgcppiaevmtgvitymltfdripeldrqgrpkmf
ysqrihdkcyrrphfdagqfveewddegarkgyclykvgckgpttynacstvrwnggtsf
piqsghgcigcsedgfwdkgsfysrdt

SCOPe Domain Coordinates for d3ayyd_:

Click to download the PDB-style file with coordinates for d3ayyd_.
(The format of our PDB-style files is described here.)

Timeline for d3ayyd_: