Lineage for d3ayxd_ (3ayx D:)

  1. Root: SCOPe 2.03
  2. 1449807Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1453668Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
    2 domains: (1) alpa/beta; (2) Fe-S cluster-bound
  4. 1453669Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) (S)
  5. 1453755Family e.19.1.0: automated matches [191636] (1 protein)
    not a true family
  6. 1453756Protein automated matches [191172] (2 species)
    not a true protein
  7. 1453762Species Hydrogenovibrio marinus [TaxId:28885] [189746] (3 PDB entries)
  8. 1453764Domain d3ayxd_: 3ayx D: [172385]
    Other proteins in same PDB: d3ayxa_, d3ayxc_
    automated match to d1yq9a1
    complexed with cmo, cyn, f3s, f4s, fe2, gol, mg, ni, o, sf4

Details for d3ayxd_

PDB Entry: 3ayx (more details), 1.18 Å

PDB Description: Membrane-bound respiratory [NiFe] hydrogenase from Hydrogenovibrio marinus in an H2-reduced condition
PDB Compounds: (D:) Membrane-bound hydrogenase small subunit

SCOPe Domain Sequences for d3ayxd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ayxd_ e.19.1.0 (D:) automated matches {Hydrogenovibrio marinus [TaxId: 28885]}
prtpviwlhglectccsesfirsahplakdvvlsmisldyddtlmaasghaaeaildeik
ekykgnyilavegnpplnqdgmsciiggrpfseqlkrmaddakaiiswgscaswgcvqaa
kpnptqatpvhkflgggydkpiikvpgcppiaevmtgvitymltfdripeldrqgrpkmf
ysqrihdkcyrrphfdagqfveewddegarkgyclykvgckgpttynacstvrwnggtsf
piqsghgcigcsedgfwdkgsfysrdt

SCOPe Domain Coordinates for d3ayxd_:

Click to download the PDB-style file with coordinates for d3ayxd_.
(The format of our PDB-style files is described here.)

Timeline for d3ayxd_: