Lineage for d3ayxb_ (3ayx B:)

  1. Root: SCOPe 2.02
  2. 1232558Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1235434Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
    2 domains: (1) alpa/beta; (2) Fe-S cluster-bound
  4. 1235435Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) (S)
  5. 1235508Family e.19.1.0: automated matches [191636] (1 protein)
    not a true family
  6. 1235509Protein automated matches [191172] (2 species)
    not a true protein
  7. 1235515Species Hydrogenovibrio marinus [TaxId:28885] [189746] (3 PDB entries)
  8. 1235516Domain d3ayxb_: 3ayx B: [172384]
    automated match to d1yq9a1
    complexed with cmo, cyn, f3s, f4s, fe2, gol, mg, ni, o, sf4

Details for d3ayxb_

PDB Entry: 3ayx (more details), 1.18 Å

PDB Description: Membrane-bound respiratory [NiFe] hydrogenase from Hydrogenovibrio marinus in an H2-reduced condition
PDB Compounds: (B:) Membrane-bound hydrogenase small subunit

SCOPe Domain Sequences for d3ayxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ayxb_ e.19.1.0 (B:) automated matches {Hydrogenovibrio marinus [TaxId: 28885]}
prtpviwlhglectccsesfirsahplakdvvlsmisldyddtlmaasghaaeaildeik
ekykgnyilavegnpplnqdgmsciiggrpfseqlkrmaddakaiiswgscaswgcvqaa
kpnptqatpvhkflgggydkpiikvpgcppiaevmtgvitymltfdripeldrqgrpkmf
ysqrihdkcyrrphfdagqfveewddegarkgyclykvgckgpttynacstvrwnggtsf
piqsghgcigcsedgfwdkgsfysrdtemnafg

SCOPe Domain Coordinates for d3ayxb_:

Click to download the PDB-style file with coordinates for d3ayxb_.
(The format of our PDB-style files is described here.)

Timeline for d3ayxb_: