Lineage for d3ayda_ (3ayd A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 943754Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 943755Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 944452Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)
  6. 944567Protein automated matches [190029] (4 species)
    not a true protein
  7. 944575Species Human (Homo sapiens) [TaxId:9606] [186749] (9 PDB entries)
  8. 944584Domain d3ayda_: 3ayd A: [172381]
    automated match to d1a3ka_
    complexed with npo, so4

Details for d3ayda_

PDB Entry: 3ayd (more details), 1.9 Å

PDB Description: crystal structure of galectin-3 crd domian complexed with tfn
PDB Compounds: (A:) Galectin-3

SCOPe Domain Sequences for d3ayda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ayda_ b.29.1.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpynlplpggvvprmlitilgtvkpnanrialdfqrgndvafhfnprfnennrrvivcnt
kldnnwgreerqsvfpfesgkpfkiqvlvepdhfkvavndahllqynhrvkklneisklg
isgdidltsasytmi

SCOPe Domain Coordinates for d3ayda_:

Click to download the PDB-style file with coordinates for d3ayda_.
(The format of our PDB-style files is described here.)

Timeline for d3ayda_: