Class b: All beta proteins [48724] (174 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins) |
Protein automated matches [190029] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186749] (9 PDB entries) |
Domain d3ayda_: 3ayd A: [172381] automated match to d1a3ka_ complexed with npo, so4 |
PDB Entry: 3ayd (more details), 1.9 Å
SCOPe Domain Sequences for d3ayda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ayda_ b.29.1.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mpynlplpggvvprmlitilgtvkpnanrialdfqrgndvafhfnprfnennrrvivcnt kldnnwgreerqsvfpfesgkpfkiqvlvepdhfkvavndahllqynhrvkklneisklg isgdidltsasytmi
Timeline for d3ayda_: