Lineage for d1tnpa_ (1tnp A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1733371Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1733372Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1733796Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 1734275Protein Troponin C [47503] (6 species)
  7. 1734276Species Chicken (Gallus gallus) [TaxId:9031] [47504] (28 PDB entries)
    Uniprot P09860
  8. 1734304Domain d1tnpa_: 1tnp A: [17238]
    N-domain only

Details for d1tnpa_

PDB Entry: 1tnp (more details)

PDB Description: structures of the apo and calcium troponin-c regulatory domains: the muscle contraction switch
PDB Compounds: (A:) troponin-c (apo)

SCOPe Domain Sequences for d1tnpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tnpa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}
asmtdqqaearaflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeelda
iieevdedgsgtidfeeflvmmvrqmkeda

SCOPe Domain Coordinates for d1tnpa_:

Click to download the PDB-style file with coordinates for d1tnpa_.
(The format of our PDB-style files is described here.)

Timeline for d1tnpa_: