Lineage for d1tnp__ (1tnp -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3180Fold a.39: EF Hand-like [47472] (3 superfamilies)
  4. 3181Superfamily a.39.1: EF-hand [47473] (7 families) (S)
  5. 3288Family a.39.1.5: Calmodulin-like [47502] (13 proteins)
  6. 3402Protein Troponin C [47503] (5 species)
  7. 3403Species Chicken (Gallus gallus) [TaxId:9031] [47504] (21 PDB entries)
  8. 3422Domain d1tnp__: 1tnp - [17238]

Details for d1tnp__

PDB Entry: 1tnp (more details)

PDB Description: structures of the apo and calcium troponin-c regulatory domains: the muscle contraction switch

SCOP Domain Sequences for d1tnp__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tnp__ a.39.1.5 (-) Troponin C {Chicken (Gallus gallus)}
asmtdqqaearaflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeelda
iieevdedgsgtidfeeflvmmvrqmkeda

SCOP Domain Coordinates for d1tnp__:

Click to download the PDB-style file with coordinates for d1tnp__.
(The format of our PDB-style files is described here.)

Timeline for d1tnp__: