Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins) |
Protein automated matches [190140] (9 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [189211] (10 PDB entries) |
Domain d3axfc_: 3axf C: [172372] automated match to d1amfa_ complexed with reo; mutant |
PDB Entry: 3axf (more details), 2 Å
SCOPe Domain Sequences for d3axfc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3axfc_ c.94.1.1 (C:) automated matches {Escherichia coli K-12 [TaxId: 83333]} gkitvfaacsltnamqdiatqfkkekgvdvvssfassstlarqieagapadlfisadqkw mdyavdkkaidtatrqtllgnslvvvapkasvqkdftidsktnwtsllnggrlavgdpeh vpagiyakealqklgawdtlspklapaedvcgalalverneaplgivygsdavaskgvkv vatfpedshkkveypvavveghnnatvkafydylkgpqaaeifkrygftik
Timeline for d3axfc_: