Lineage for d3ax8a_ (3ax8 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335122Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2335123Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2335124Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2336099Protein Vitamin D nuclear receptor [48528] (2 species)
  7. 2336100Species Human (Homo sapiens) [TaxId:9606] [48529] (30 PDB entries)
  8. 2336125Domain d3ax8a_: 3ax8 A: [172369]
    automated match to d1ie9a_
    complexed with eim

Details for d3ax8a_

PDB Entry: 3ax8 (more details), 2.6 Å

PDB Description: crystal structure of the human vitamin d receptor ligand binding domain complexed with 15alpha-methoxy-1alpha,25-dihydroxyvitamin d3
PDB Compounds: (A:) Vitamin D3 receptor

SCOPe Domain Sequences for d3ax8a_:

Sequence, based on SEQRES records: (download)

>d3ax8a_ a.123.1.1 (A:) Vitamin D nuclear receptor {Human (Homo sapiens) [TaxId: 9606]}
dslrpklseeqqriiailldahhktydptysdfcqfrppvrvndgggsvtlelsqlsmlp
hladlvsysiqkvigfakmipgfrdltsedqivllkssaievimlrsnesftmddmswtc
gnqdykyrvsdvtkaghslelieplikfqvglkklnlheeehvllmaicivspdrpgvqd
aalieaiqdrlsntlqtyircrhpppgshllyakmiqkladlrslneehskqyrclsfqp
ecsmkltplvlevfg

Sequence, based on observed residues (ATOM records): (download)

>d3ax8a_ a.123.1.1 (A:) Vitamin D nuclear receptor {Human (Homo sapiens) [TaxId: 9606]}
dslrpklseeqqriiailldahhktydptysdfcqfrppvrvndgsvtlelsqlsmlphl
adlvsysiqkvigfakmipgfrdltsedqivllkssaievimlrsnesftmddmswtcgn
qdykyrvsdvtkaghslelieplikfqvglkklnlheeehvllmaicivspdrpgvqdaa
lieaiqdrlsntlqtyircrhpppgshllyakmiqkladlrslneehskqyrclsfqpec
smkltplvlevfg

SCOPe Domain Coordinates for d3ax8a_:

Click to download the PDB-style file with coordinates for d3ax8a_.
(The format of our PDB-style files is described here.)

Timeline for d3ax8a_: