Lineage for d3awpa_ (3awp A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1277465Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 1277466Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 1278000Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 1278001Protein automated matches [190847] (33 species)
    not a true protein
  7. 1278245Species Sphingomonas paucimobilis [TaxId:13689] [190001] (7 PDB entries)
  8. 1278247Domain d3awpa_: 3awp A: [172367]
    automated match to d1izoa_
    complexed with hem, mrd, plm; mutant

Details for d3awpa_

PDB Entry: 3awp (more details), 1.8 Å

PDB Description: Cytochrome P450SP alpha (CYP152B1) mutant F288G
PDB Compounds: (A:) Fatty acid alpha-hydroxylase

SCOPe Domain Sequences for d3awpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3awpa_ a.104.1.0 (A:) automated matches {Sphingomonas paucimobilis [TaxId: 13689]}
gpdetlslladpyrfisrqcqrlganafesrfllkktnclkgakaaeifydttrferega
mpvaiqktllgqggvqgldgethrhrkqmfmglmtpervralaqlfeaewrravpgwtrk
geivfydelhepltravcawagvplpddeagnragelralfdaagsasprhlwsrlarrr
vdawakriiegiragsigsgsgtaayaiawhrdrhddllsphvaavelvnvlrptvaiav
yitfvahalqtcsgiraalvqqpdyaelfvqevrrfypfgpavvarasqdfewegmafpe
grqvvldlygsnhdaatwadpqefrperfrawdedsfnfipqgggdhylghrcpgewivl
aimkvaahllvnamrydvpdqdlsidfarlpalpksgfvmrnvhigg

SCOPe Domain Coordinates for d3awpa_:

Click to download the PDB-style file with coordinates for d3awpa_.
(The format of our PDB-style files is described here.)

Timeline for d3awpa_: