| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (51 species) not a true protein |
| Species Gluconobacter oxydans [TaxId:442] [186908] (2 PDB entries) |
| Domain d3awdd_: 3awd D: [172365] automated match to d1vl8a_ complexed with cd, mg |
PDB Entry: 3awd (more details), 1.8 Å
SCOPe Domain Sequences for d3awdd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3awdd_ c.2.1.0 (D:) automated matches {Gluconobacter oxydans [TaxId: 442]}
mymeklrldnrvaivtggaqniglacvtalaeagarviiadldeamatkavedlrmeghd
vssvvmdvtntesvqnavrsvheqegrvdilvacagicisevkaedmtdgqwlkqvdinl
ngmfrscqavgrimleqkqgvivaigsmsglivnrpqqqaaynaskagvhqyirslaaew
aphgiranavaptyiettltrfgmekpelydawiagtpmgrvgqpdevasvvqflasdaa
slmtgaivnvdagftvw
Timeline for d3awdd_: