Lineage for d3aw1b_ (3aw1 B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2387558Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2387559Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2389935Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 protein domains)
  6. 2389994Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (6 species)
    contains an extra alpha-helical domain
  7. 2390016Species SARS coronavirus [TaxId:227859] [89349] (73 PDB entries)
  8. 2390075Domain d3aw1b_: 3aw1 B: [172361]
    automated match to d1uj1b_
    mutant

Details for d3aw1b_

PDB Entry: 3aw1 (more details), 2 Å

PDB Description: Structure of SARS 3CL protease auto-proteolysis resistant mutant in the absent of inhibitor
PDB Compounds: (B:) 3C-like proteinase

SCOPe Domain Sequences for d3aw1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3aw1b_ b.47.1.4 (B:) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {SARS coronavirus [TaxId: 227859]}
sgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllir
ksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyng
spsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegk
fygpfvdiqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynye
pltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqc

SCOPe Domain Coordinates for d3aw1b_:

Click to download the PDB-style file with coordinates for d3aw1b_.
(The format of our PDB-style files is described here.)

Timeline for d3aw1b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3aw1a_