SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3aw1a_ (3aw1 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2057856Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 protein domains)
  6. 2057913Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (6 species)
    contains an extra alpha-helical domain
  7. 2057935Species SARS coronavirus [TaxId:227859] [89349] (71 PDB entries)
  8. 2057996Domain d3aw1a_: 3aw1 A: [172360]
    automated match to d1uj1b_
    mutant

Details for d3aw1a_

PDB Entry: 3aw1 (more details), 2 Å

PDB Description: Structure of SARS 3CL protease auto-proteolysis resistant mutant in the absent of inhibitor
PDB Compounds: (A:) 3C-like proteinase

SCOPe Domain Sequences for d3aw1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3aw1a_ b.47.1.4 (A:) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {SARS coronavirus [TaxId: 227859]}
sgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllir
ksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyng
spsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegk
fygpfvdiqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynye
pltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqc
s

SCOPe Domain Coordinates for d3aw1a_:

Click to download the PDB-style file with coordinates for d3aw1a_.
(The format of our PDB-style files is described here.)

Timeline for d3aw1a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3aw1b_