Lineage for d3av8b_ (3av8 B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1892544Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1894040Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 1894041Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)
  6. 1894169Protein automated matches [190231] (8 species)
    not a true protein
  7. 1894170Species Aphanothece sacrum [TaxId:1122] [189862] (1 PDB entry)
  8. 1894172Domain d3av8b_: 3av8 B: [172349]
    automated match to d1fxia_
    complexed with fes, so4

Details for d3av8b_

PDB Entry: 3av8 (more details), 1.46 Å

PDB Description: Refined Structure of Plant-type [2Fe-2S] Ferredoxin I from Aphanothece sacrum at 1.46 A Resolution
PDB Compounds: (B:) Ferredoxin-1

SCOPe Domain Sequences for d3av8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3av8b_ d.15.4.1 (B:) automated matches {Aphanothece sacrum [TaxId: 1122]}
asykvtlktpdgdnvitvpddeyildvaeeqgldlpyscragacstcagklvsgpapdqs
dqsfldddqiqagyiltcvayptgdcviethkeealy

SCOPe Domain Coordinates for d3av8b_:

Click to download the PDB-style file with coordinates for d3av8b_.
(The format of our PDB-style files is described here.)

Timeline for d3av8b_: