Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) |
Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins) |
Protein automated matches [190231] (8 species) not a true protein |
Species Aphanothece sacrum [TaxId:1122] [189862] (1 PDB entry) |
Domain d3av8b_: 3av8 B: [172349] automated match to d1fxia_ complexed with fes, so4 |
PDB Entry: 3av8 (more details), 1.46 Å
SCOPe Domain Sequences for d3av8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3av8b_ d.15.4.1 (B:) automated matches {Aphanothece sacrum [TaxId: 1122]} asykvtlktpdgdnvitvpddeyildvaeeqgldlpyscragacstcagklvsgpapdqs dqsfldddqiqagyiltcvayptgdcviethkeealy
Timeline for d3av8b_: