SCOPe 2.01: Domain d3av2e_: 3av2 E:

Lineage for d3av2e_ (3av2 E:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (4 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein automated matches [190203] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187038] (6 PDB entries)

8. Domain d3av2e_: 3av2 E: [172347]
   automated match to d1kx5a_
   protein/DNA complex

Details for d3av2e_

PDB Entry: 3av2, 2.8 Å

PDB Description: The human nucleosome structure containing the histone variant H3.3

PDB Compounds: (E:) Histone H3.2

SCOPe Domain Sequences for d3av2e_:

Sequence; same for both SEQRES and ATOM records:

>d3av2e_ a.22.1.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqsaaigalqease
aylvglfedtnlcaihakrvtimpkdiqlarrirgera

Timeline for d3av2e_:

• d3av2e_ is new in SCOPe 2.01-stable
  
• d3av2e_ appears in SCOPe 2.02
  
• d3av2e_ appears in the current release, SCOPe 2.08