Lineage for d3atzd_ (3atz D:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1816697Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 1817199Family c.1.4.0: automated matches [191310] (1 protein)
    not a true family
  6. 1817200Protein automated matches [190048] (17 species)
    not a true protein
  7. 1817324Species Trypanosoma cruzi [TaxId:5693] [189890] (4 PDB entries)
  8. 1817331Domain d3atzd_: 3atz D: [172340]
    automated match to d1icpa_
    complexed with fmn, hba

Details for d3atzd_

PDB Entry: 3atz (more details), 2.04 Å

PDB Description: Crystal structure of TcOYE with pHBA
PDB Compounds: (D:) Prostaglandin F2a synthase

SCOPe Domain Sequences for d3atzd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3atzd_ c.1.4.0 (D:) automated matches {Trypanosoma cruzi [TaxId: 5693]}
atfpellrplklgrytlrnriimapltrcqateddhvprtesmlkyyedrasagliiaea
tmvqpnytgfltepgiysdaqieewrkivdavhkkggliflqlihagragipekilqqsk
sdqdplagrllaasaipikdhripayfaasgeketygvpeeltddevrdgiiplfvegak
naifkagfdgveihgangylldaffressnkrqsgpyagttidtrcqliydvtksvcdav
gsdrvglrisplngvhgmidsnpealtkhlckkieplslaylhylrgdmvnqqigdvvaw
vrgsysgvkisnlrydfeeadqqiregkvdavafgakfianpdlveraqqnwplneprpe
tyytrtavgyndypty

SCOPe Domain Coordinates for d3atzd_:

Click to download the PDB-style file with coordinates for d3atzd_.
(The format of our PDB-style files is described here.)

Timeline for d3atzd_: