SCOP 1.73: Domain d1smga_: 1smg A:

Lineage for d1smga_ (1smg A:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (11 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (23 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Troponin C [47503] (6 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [47504] (28 PDB entries)

8. Domain d1smga_: 1smg A: [17234]
   N-domain only
   complexed with ca; mutant

Details for d1smga_

PDB Entry: 1smg

PDB Description: calcium-bound e41a mutant of the n-domain of chicken troponin c, nmr, 40 structures

PDB Compounds: (A:) troponin c

SCOP Domain Sequences for d1smga_:

Sequence; same for both SEQRES and ATOM records:

>d1smga_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}
asmtdqqaearaflseemiaefkaafdmfdadgggdistkalgtvmrmlgqnptkeelda
iieevdedgsgtidfeeflvmmvrqmkeda

Timeline for d1smga_:

• d1smga_ first appeared (with stable ids) in SCOP 1.55, called d1smg__
  
• d1smga_ was called d1smg__ in SCOP 1.71
  
• d1smga_ appears in SCOP 1.75
  
• d1smga_ appears in the current release, SCOPe 2.08