Lineage for d1smg__ (1smg -)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 442523Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 442524Superfamily a.39.1: EF-hand [47473] (10 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 442704Family a.39.1.5: Calmodulin-like [47502] (23 proteins)
    Duplication: made with two pairs of EF-hands
  6. 442946Protein Troponin C [47503] (6 species)
  7. 442947Species Chicken (Gallus gallus) [TaxId:9031] [47504] (24 PDB entries)
  8. 442961Domain d1smg__: 1smg - [17234]
    N-domain only

Details for d1smg__

PDB Entry: 1smg (more details)

PDB Description: calcium-bound e41a mutant of the n-domain of chicken troponin c, nmr, 40 structures

SCOP Domain Sequences for d1smg__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1smg__ a.39.1.5 (-) Troponin C {Chicken (Gallus gallus)}
asmtdqqaearaflseemiaefkaafdmfdadgggdistkalgtvmrmlgqnptkeelda
iieevdedgsgtidfeeflvmmvrqmkeda

SCOP Domain Coordinates for d1smg__:

Click to download the PDB-style file with coordinates for d1smg__.
(The format of our PDB-style files is described here.)

Timeline for d1smg__: