SCOPe 2.05: Domain d3atyb_: 3aty B:

Lineage for d3atyb_ (3aty B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families)

5. Family c.1.4.0: automated matches [191310] (1 protein)
   not a true family

6. Protein automated matches [190048] (17 species)
   not a true protein

7. Species Trypanosoma cruzi [TaxId:5693] [189890] (4 PDB entries)

8. Domain d3atyb_: 3aty B: [172336]
   automated match to d1icpa_
   complexed with fmn

Details for d3atyb_

PDB Entry: 3aty, 1.7 Å

PDB Description: Crystal structure of TcOYE

PDB Compounds: (B:) Prostaglandin F2a synthase

SCOPe Domain Sequences for d3atyb_:

Sequence; same for both SEQRES and ATOM records:

>d3atyb_ c.1.4.0 (B:) automated matches {Trypanosoma cruzi [TaxId: 5693]}
matfpellrplklgrytlrnriimapltrcqateddhvprtesmlkyyedrasagliiae
atmvqpnytgfltepgiysdaqieewrkivdavhkkggliflqlihagragipekilqqs
ksdqdplagrllaasaipikdhripayfaasgeketygvpeeltddevrdgiiplfvega
knaifkagfdgveihgangylldaffressnkrqsgpyagttidtrcqliydvtksvcda
vgsdrvglrisplngvhgmidsnpealtkhlckkieplslaylhylrgdmvnqqigdvva
wvrgsysgvkisnlrydfeeadqqiregkvdavafgakfianpdlveraqqnwplneprp
etyytrtavgyndypty

Timeline for d3atyb_:

• d3atyb_ first appeared in SCOPe 2.01
  
• d3atyb_ appears in SCOPe 2.04
  
• d3atyb_ appears in SCOPe 2.06
  
• d3atyb_ appears in the current release, SCOPe 2.08