| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
| Protein automated matches [190359] (43 species) not a true protein |
| Species Podocnemis unifilis [TaxId:227871] [189922] (2 PDB entries) |
| Domain d3at6a_: 3at6 A: [172330] automated match to d1fawa_ protein/DNA complex; complexed with hem |
PDB Entry: 3at6 (more details), 2.35 Å
SCOPe Domain Sequences for d3at6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3at6a_ a.1.1.2 (A:) automated matches {Podocnemis unifilis [TaxId: 227871]}
vlspgdkanvktvwskvsghvedygaetlerlfrvypstktyfphfdlhhdsaqirthgk
kvltaigeavshiddiasalsklsdlhaqtlrvdpvnfkllshsflvvlavhapslltpe
vhvsldkflvavsnvltskyr
Timeline for d3at6a_: