Lineage for d3at5a_ (3at5 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2688401Protein automated matches [190359] (43 species)
    not a true protein
  7. 2688767Species Podocnemis unifilis [TaxId:227871] [189922] (2 PDB entries)
  8. 2688768Domain d3at5a_: 3at5 A: [172328]
    automated match to d1fawa_
    protein/DNA complex; complexed with hem

Details for d3at5a_

PDB Entry: 3at5 (more details), 2.2 Å

PDB Description: Side-necked turtle (Pleurodira, Chelonia, REPTILIA) hemoglobin: cDNA-derived primary structures and X-ray crystal structures of Hb A
PDB Compounds: (A:) AlphaA-globin

SCOPe Domain Sequences for d3at5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3at5a_ a.1.1.2 (A:) automated matches {Podocnemis unifilis [TaxId: 227871]}
vlspgdkanvktvwskvsghvedygaetlerlfrvypstktyfphfdlhhdsaqirthgk
kvltaigeavshiddiasalsklsdlhaqtlrvdpvnfkllshsflvvlavhapslltpe
vhvsldkflvavsnvltskyr

SCOPe Domain Coordinates for d3at5a_:

Click to download the PDB-style file with coordinates for d3at5a_.
(The format of our PDB-style files is described here.)

Timeline for d3at5a_: