Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)
Search SCOP (example):

Lineage for d3arcv_ (3arc V:)

  1. Root: SCOP 1.75B
  2. Class a: All alpha proteins [46456] (284 folds)
  3. Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. Family a.3.1.1: monodomain cytochrome c [46627] (16 protein domains)
  6. Protein automated matches [190113] (11 species)
    not a true protein
  7. Species Thermosynechococcus vulcanus [TaxId:32053] [189921] (1 PDB entry)
  8. Domain d3arcv_: 3arc V: [172320]
    Other proteins in same PDB: d3arca_, d3arcb_, d3arcc_, d3arcd_, d3arce_, d3arcf_, d3arch_, d3arcj_, d3arck_, d3arcl_, d3arcm_, d3arco_, d3arcu_, d3arcz_
    automated match to d1mz4a_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d3arcv_

PDB Entry: 3arc (more details)
PDB Description: crystal structure of oxygen-evolving photosystem ii at 1.9 a resolution
PDB Compounds: (V:) cytochrome c-550

SCOP Domain Sequences for d3arcv_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3arcv_ a.3.1.1 (V:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
aeltpevltvplnsegktitltekqylegkrlfqyacaschvggitktnpsldlrtetla
latpprdnieglvdymknpttydgeqeiaevhpslrsadifpkmrnltekdlvaiaghil
vepkilgdkwgggkvyy

SCOP Domain Coordinates for d3arcv_:

Click to download the PDB-style file with coordinates for d3arcv_.
(The format of our PDB-style files is described here.)

Timeline for d3arcv_:

d3arcv_ appears in SCOP 1.75A


d3arcv_
(click for larger image)


d3arcv_ in context of chain



d3arcv_ in context of PDB
Domains from other chains:
d3arca_, d3arcb_, d3arcc_, d3arcd_, d3arce_, d3arcf_, d3arch_, d3arcj_, d3arck_, d3arcl_, d3arcm_, d3arco_, d3arcu_, d3arcz_

SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu