Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)
Search SCOP (example):

Lineage for d3arcm_ (3arc M:)

  1. Root: SCOP 1.75B
  2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. Superfamily f.23.35: Photosystem II reaction center protein M, PsbM [161033] (1 family) (S)
  5. Family f.23.35.1: PsbM-like [161034] (1 protein)
    Pfam PF05151
  6. Protein Photosystem II reaction center protein M, PsbM [161035] (2 species)
  7. Species Thermosynechococcus vulcanus [TaxId:32053] [189918] (1 PDB entry)
  8. Domain d3arcm_: 3arc M: [172317]
    Other proteins in same PDB: d3arca_, d3arcb_, d3arcc_, d3arcd_, d3arce_, d3arcf_, d3arch_, d3arcj_, d3arck_, d3arcl_, d3arco_, d3arcu_, d3arcv_, d3arcz_
    automated match to d2axtm1
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d3arcm_

PDB Entry: 3arc (more details)
PDB Description: crystal structure of oxygen-evolving photosystem ii at 1.9 a resolution
PDB Compounds: (M:) Photosystem II reaction center protein M

SCOP Domain Sequences for d3arcm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3arcm_ f.23.35.1 (M:) Photosystem II reaction center protein M, PsbM {Thermosynechococcus vulcanus [TaxId: 32053]}
mevnqlgliatalfvlvpsvfliilyvqtesqqk

SCOP Domain Coordinates for d3arcm_:

Click to download the PDB-style file with coordinates for d3arcm_.
(The format of our PDB-style files is described here.)

Timeline for d3arcm_:

d3arcm_ appears in SCOP 1.75A


d3arcm_
(click for larger image)


d3arcm_ in context of chain



d3arcm_ in context of PDB
Domains from other chains:
d3arca_, d3arcb_, d3arcc_, d3arcd_, d3arce_, d3arcf_, d3arch_, d3arcj_, d3arck_, d3arcl_, d3arco_, d3arcu_, d3arcv_, d3arcz_

SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu