Domain d3arcl_: 3arc L:

Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)

Lineage for d3arcl_ (3arc L:)

Root: SCOP 1.75B
Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
not a true fold
Superfamily f.23.31: Photosystem II reaction center protein L, PsbL [161017] (1 family)
Family f.23.31.1: PsbL-like [161018] (2 protein domains)
Pfam PF02419
Protein automated matches [191003] (2 species)
not a true protein
Species Thermosynechococcus vulcanus [TaxId:32053] [189917] (1 PDB entry)

Domain d3arcl_: 3arc L: [172316]
Other proteins in same PDB: d3arca_, d3arcb_, d3arcc_, d3arcd_, d3arce_, d3arcf_, d3arch_, d3arcj_, d3arck_, d3arcm_, d3arco_, d3arcu_, d3arcv_, d3arcz_
automated match to d2axtl1
complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

PDB Entry: 3arc (more details)
PDB Description: crystal structure of oxygen-evolving photosystem ii at 1.9 a resolution
PDB Compounds: (L:) Photosystem II reaction center protein L

SCOP Domain Sequences for d3arcl_:
Sequence; same for both SEQRES and ATOM records: (download)

>d3arcl_ f.23.31.1 (L:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]} mepnpnrqpvelnrtslylglllilvlallfssyffn

SCOP Domain Coordinates for d3arcl_:

Click to download the PDB-style file with coordinates for d3arcl_.
(The format of our PDB-style files is described here.)

Timeline for d3arcl_:
d3arcl_ appears in SCOP 1.75A

d3arcl_
(click for larger image)

d3arcl_ in context of chain

d3arcl_ in context of PDB
Domains from other chains:
d3arca_, d3arcb_, d3arcc_, d3arcd_, d3arce_, d3arcf_, d3arch_, d3arcj_, d3arck_, d3arcm_, d3arco_, d3arcu_, d3arcv_, d3arcz_