| Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
| Fold f.23: Single transmembrane helix [81407] (38 superfamilies) not a true fold |
Superfamily f.23.33: Photosystem II 10 kDa phosphoprotein PsbH [161025] (1 family) ![]() |
| Family f.23.33.1: PsbH-like [161026] (2 protein domains) Pfam PF00737 |
| Protein automated matches [191001] (2 species) not a true protein |
| Species Thermosynechococcus vulcanus [TaxId:32053] [189915] (1 PDB entry) |
| Domain d3arch_: 3arc H: [172314] Other proteins in same PDB: d3arca_, d3arcb_, d3arcc_, d3arcd_, d3arce_, d3arcf_, d3arcj_, d3arck_, d3arcl_, d3arcm_, d3arco_, d3arcu_, d3arcv_, d3arcz_ automated match to d2axth1 complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl |
| PDB Entry: 3arc (more details) PDB Description: crystal structure of oxygen-evolving photosystem ii at 1.9 a resolution
PDB Compounds: (H:) Photosystem II reaction center protein HSCOP Domain Sequences for d3arch_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3arch_ f.23.33.1 (H:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
arrtwlgdilrplnseygkvapgwgttplmavfmglflvflliileiynstlildgvnvs
wkalg
SCOP Domain Coordinates for d3arch_:
Click to download the PDB-style file with coordinates for d3arch_. (The format of our PDB-style files is described here.)
Timeline for d3arch_:
d3arch_ appears in SCOP 1.75A | d3arch_ (click for larger image) d3arch_ in context of chain d3arch_ in context of PDB Domains from other chains: d3arca_, d3arcb_, d3arcc_, d3arcd_, d3arce_, d3arcf_, d3arcj_, d3arck_, d3arcl_, d3arcm_, d3arco_, d3arcu_, d3arcv_, d3arcz_ |
|
|
Copyright © 1994-2013 The SCOP
and Astral authors scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu |