Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)
Search SCOP (example):

Lineage for d3arcd_ (3arc D:)

  1. Root: SCOP 1.75B
  2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
  5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 protein domains)
    L and M are probably related to each other
  6. Protein automated matches [190224] (5 species)
    not a true protein
  7. Species Thermosynechococcus vulcanus [TaxId:32053] [189911] (1 PDB entry)
  8. Domain d3arcd_: 3arc D: [172311]
    Other proteins in same PDB: d3arcb_, d3arcc_, d3arce_, d3arcf_, d3arch_, d3arcj_, d3arck_, d3arcl_, d3arcm_, d3arco_, d3arcu_, d3arcv_, d3arcz_
    automated match to d2axtd1
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d3arcd_

PDB Entry: 3arc (more details)
PDB Description: crystal structure of oxygen-evolving photosystem ii at 1.9 a resolution
PDB Compounds: (D:) Photosystem II reaction center D2 protein

SCOP Domain Sequences for d3arcd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3arcd_ f.26.1.1 (D:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
ergwfdilddwlkrdrfvfvgwsgillfpcaylalggwltgttfvtswythglassyleg
cnfltvavstpansmghsllllwgpeaqgdftrwcqlgglwtfialhgafgligfmlrqf
eiarlvgvrpynaiafsapiavfvsvfliyplgqsswffapsfgvaaifrfllffqgfhn
wtlnpfhmmgvagvlggallcaihgatventlfqdgegastfrafnptqaeetysmvtan
rfwsqifgiafsnkrwlhffmlfvpvtglwmsaigvvglalnlrsydfisqeiraaedpe
fetfytknlllnegirawmapqdqphenfvfpeevlprgnal

SCOP Domain Coordinates for d3arcd_:

Click to download the PDB-style file with coordinates for d3arcd_.
(The format of our PDB-style files is described here.)

Timeline for d3arcd_:

d3arcd_ appears in SCOP 1.75A


d3arcd_
(click for larger image)


d3arcd_ in context of chain



d3arcd_ in context of PDB
Domains from other chains:
d3arca_, d3arcb_, d3arcc_, d3arce_, d3arcf_, d3arch_, d3arcj_, d3arck_, d3arcl_, d3arcm_, d3arco_, d3arcu_, d3arcv_, d3arcz_

SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu