Lineage for d3aq4b_ (3aq4 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2866676Protein ADP-ribosylation factor [52614] (17 species)
  7. 2866771Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [189615] (1 PDB entry)
  8. 2866773Domain d3aq4b_: 3aq4 B: [172301]
    automated match to d1hura_
    complexed with gdp, mg

Details for d3aq4b_

PDB Entry: 3aq4 (more details), 1.8 Å

PDB Description: Molecular insights into plant cell proliferation disturbance by Agrobacterium protein 6b
PDB Compounds: (B:) ADP-ribosylation factor 1

SCOPe Domain Sequences for d3aq4b_:

Sequence, based on SEQRES records: (download)

>d3aq4b_ c.37.1.8 (B:) ADP-ribosylation factor {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
sfgklfsrlfakkemrilmvgldaagkttilyklklgeivttiptigfnvetveyknisf
tvwdvggqdkirplwrhyfqntqglifvvdsndrdrvveardelhrmlnedelrdavllv
fankqdlpnamnaaeitdklglhslrqrhwyiqstcatsgeglyegldwlsnniask

Sequence, based on observed residues (ATOM records): (download)

>d3aq4b_ c.37.1.8 (B:) ADP-ribosylation factor {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
sfgklfsrlfakkemrilmvgldaagkttilyklklgeivttiptigfnvetveyknisf
tvwdvgntqglifvvdsndrdrvveardelhrmlnedelrdavllvfankqdlpnamnaa
eitdklglhslrqrhwyiqstcatsgeglyegldwlsnniask

SCOPe Domain Coordinates for d3aq4b_:

Click to download the PDB-style file with coordinates for d3aq4b_.
(The format of our PDB-style files is described here.)

Timeline for d3aq4b_: