![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 proteins) |
![]() | Protein automated matches [190245] (12 species) not a true protein |
![]() | Species Pyrococcus furiosus [TaxId:2261] [189762] (2 PDB entries) |
![]() | Domain d3apgb1: 3apg B:2-471 [172297] Other proteins in same PDB: d3apga2, d3apgb2, d3apgc2, d3apgd2 automated match to d1qvba_ complexed with gol |
PDB Entry: 3apg (more details), 2.35 Å
SCOPe Domain Sequences for d3apgb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3apgb1 c.1.8.4 (B:2-471) automated matches {Pyrococcus furiosus [TaxId: 2261]} kfpknfmfgyswsgfqfemglpgsevesdwwvwvhdkeniasglvsgdlpengpaywhly kqdhdiaeklgmdcirggiewarifpkptfdvkvdvekdeegniisvdvpestikeleki anmealehyrkiysdwkergktfilnlyhwplplwihdpiavrklgpdrapagwldektv vefvkfaafvayhlddlvdmwstmnepnvvynqgyinlrsgfppgylsfeaaekakfnli qahigaydaikeyseksvgviyafawhdplaeeykdeveeirkkdyefvtilhskgkldw igvnyysrlvygakdghlvplpgygfmserggfaksgrpasdfgwemypeglenllkyln nayelpmiitengmadaadryrphylvshlkavynamkegadvrgylhwsltdnyewaqg frmrfglvyvdfetkkrylrpsalvfreiatqkeipeelahladlkfvtr
Timeline for d3apgb1: