SCOPe 2.05: Domain d3apga_: 3apg A:

Lineage for d3apga_ (3apg A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 proteins)

6. Protein automated matches [190245] (10 species)
   not a true protein

7. Species Pyrococcus furiosus [TaxId:2261] [189762] (2 PDB entries)

8. Domain d3apga_: 3apg A: [172296]
   automated match to d1qvba_
   complexed with gol

Details for d3apga_

PDB Entry: 3apg, 2.35 Å

PDB Description: crystal structure of hyperthermophilic beta-glucosidase from pyrococcus furiosus

PDB Compounds: (A:) Beta-glucosidase

SCOPe Domain Sequences for d3apga_:

Sequence; same for both SEQRES and ATOM records:

>d3apga_ c.1.8.4 (A:) automated matches {Pyrococcus furiosus [TaxId: 2261]}
akfpknfmfgyswsgfqfemglpgsevesdwwvwvhdkeniasglvsgdlpengpaywhl
ykqdhdiaeklgmdcirggiewarifpkptfdvkvdvekdeegniisvdvpestikelek
ianmealehyrkiysdwkergktfilnlyhwplplwihdpiavrklgpdrapagwldekt
vvefvkfaafvayhlddlvdmwstmnepnvvynqgyinlrsgfppgylsfeaaekakfnl
iqahigaydaikeyseksvgviyafawhdplaeeykdeveeirkkdyefvtilhskgkld
wigvnyysrlvygakdghlvplpgygfmserggfaksgrpasdfgwemypeglenllkyl
nnayelpmiitengmadaadryrphylvshlkavynamkegadvrgylhwsltdnyewaq
gfrmrfglvyvdfetkkrylrpsalvfreiatqkeipeelahladlkfvtr

Timeline for d3apga_:

• d3apga_ first appeared in SCOPe 2.01
  
• d3apga_ appears in SCOPe 2.04
  
• d3apga_ is called d3apga1 in SCOPe 2.06
  
• d3apga_ appears in the current release, SCOPe 2.08, called d3apga1