SCOPe 2.01: Domain d3apba_: 3apb A:

Lineage for d3apba_ (3apb A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (11 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187655] (21 PDB entries)

8. Domain d3apba_: 3apb A: [172294]
   automated match to d1a3ka_
   complexed with iod

Details for d3apba_

PDB Entry: 3apb, 1.95 Å

PDB Description: Crystal structure of the galectin-8 N-terminal carbohydrate recognition domain in complex with iodide

PDB Compounds: (A:) Galectin-8

SCOPe Domain Sequences for d3apba_:

Sequence; same for both SEQRES and ATOM records:

>d3apba_ b.29.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lslnnlqniiynpvipfvgtipdqldpgtlivirghvpsdadrfqvdlqngssvkpradv
afhfnprfkragcivcntlinekwgreeitydtpfkreksfeivimvlkdkfqvavngkh
tllyghrigpekidtlgiygkvnihsigfsfs

Timeline for d3apba_:

• d3apba_ is new in SCOPe 2.01-stable
  
• d3apba_ appears in SCOPe 2.02
  
• d3apba_ appears in the current release, SCOPe 2.08