Lineage for d3ap6c_ (3ap6 C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2390272Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2390273Protein automated matches [190437] (66 species)
    not a true protein
  7. 2390546Species Human (Homo sapiens) [TaxId:9606] [187655] (107 PDB entries)
  8. 2390581Domain d3ap6c_: 3ap6 C: [172290]
    automated match to d1a3ka_
    complexed with lat, so4

Details for d3ap6c_

PDB Entry: 3ap6 (more details), 1.58 Å

PDB Description: crystal structure of the galectin-8 n-terminal carbohydrate recognition domain in complex with lactose 3'-sulfate
PDB Compounds: (C:) Galectin-8

SCOPe Domain Sequences for d3ap6c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ap6c_ b.29.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lqniiynpvipfvgtipdqldpgtlivirghvpsdadrfqvdlqngssvkpradvafhfn
prfkragcivcntlinekwgreeitydtpfkreksfeivimvlkdkfqvavngkhtllyg
hrigpekidtlgiygkvnihsigfs

SCOPe Domain Coordinates for d3ap6c_:

Click to download the PDB-style file with coordinates for d3ap6c_.
(The format of our PDB-style files is described here.)

Timeline for d3ap6c_: