Lineage for d3ap6b_ (3ap6 B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 943754Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 943755Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 945308Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 945309Protein automated matches [190437] (11 species)
    not a true protein
  7. 945336Species Human (Homo sapiens) [TaxId:9606] [187655] (21 PDB entries)
  8. 945344Domain d3ap6b_: 3ap6 B: [172289]
    automated match to d1a3ka_
    complexed with lat, so4

Details for d3ap6b_

PDB Entry: 3ap6 (more details), 1.58 Å

PDB Description: crystal structure of the galectin-8 n-terminal carbohydrate recognition domain in complex with lactose 3'-sulfate
PDB Compounds: (B:) Galectin-8

SCOPe Domain Sequences for d3ap6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ap6b_ b.29.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qniiynpvipfvgtipdqldpgtlivirghvpsdadrfqvdlqngssvkpradvafhfnp
rfkragcivcntlinekwgreeitydtpfkreksfeivimvlkdkfqvavngkhtllygh
rigpekidtlgiygkvnihsigfsf

SCOPe Domain Coordinates for d3ap6b_:

Click to download the PDB-style file with coordinates for d3ap6b_.
(The format of our PDB-style files is described here.)

Timeline for d3ap6b_: