SCOPe 2.08: Domain d3ao1b_: 3ao1 B:

Lineage for d3ao1b_ (3ao1 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families)
   consists of one domain of this fold

5. Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)
   Pfam PF00665

6. Protein Retroviral integrase, catalytic domain [53108] (5 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [53110] (74 PDB entries)

8. Domain d3ao1b_: 3ao1 B: [172280]
   automated match to d1bi4c_
   protein/DNA complex; complexed with bzx, cd, so4

Details for d3ao1b_

PDB Entry: 3ao1, 1.9 Å

PDB Description: Fragment-based approach to the design of ligands targeting a novel site in HIV-1 integrase

PDB Compounds: (B:) Pol polyprotein

SCOPe Domain Sequences for d3ao1b_:

Sequence, based on SEQRES records:

>d3ao1b_ c.55.3.2 (B:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
ngsnftsttvkaacdwagikqedgipynpqsqgviesmnkelkkiigqvrdqaehlktav
qmavfihnhkrkggiggysagerivdiiatdi

Sequence, based on observed residues (ATOM records):

>d3ao1b_ c.55.3.2 (B:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
ngsnftsttvkaacdwagikqegviesmnkelkkiigqvrdqaehlktavqmavfihnhk
rkggiggysagerivdiiatdi

Timeline for d3ao1b_:

• d3ao1b_ first appeared in SCOPe 2.01
  
• d3ao1b_ appears in SCOPe 2.07