Lineage for d4tnc__ (4tnc -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) Fold a.39: EF Hand-like [47472] (3 superfamilies) Superfamily a.39.1: EF-hand [47473] (7 families) 
Family a.39.1.5: Calmodulin-like [47502] (13 proteins) 
Protein Troponin C [47503] (5 species) Species Chicken (Gallus gallus) [TaxId:9031] [47504] (21 PDB entries) 
Domain d4tnc__: 4tnc - [17228]
Details for d4tnc__
PDB Entry: 4tnc (more details), 2 Å
PDB Description: refined structure of chicken skeletal muscle troponin c in the two-calcium state at 2-angstroms resolution
SCOP Domain Sequences for d4tnc__:
Sequence; same for both SEQRES and ATOM records: (download)
>d4tnc__ a.39.1.5 (-) Troponin C {Chicken (Gallus gallus)}
amdqqaearaflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeeldaii
eevdedgsgtidfeeflvmmvrqmkedakgkseeeladcfrifdknadgfidieelgeil
ratgehvteediedlmkdsdknndgridfdeflkmmegvq
SCOP Domain Coordinates for d4tnc__:
Click to download the PDB-style file with coordinates for d4tnc__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4tnc__:
- d4tnc__ appears in SCOP 1.57
- d4tnc__ appears in the current release, SCOPe 2.08, called d4tnca_
View in 3D