Lineage for d3anzu1 (3anz U:1-293)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3022603Fold f.6: Leukocidin-like [56958] (1 superfamily)
    subunit fold contains beta-sandwich of Ig-like (greek-key) topology and a beta-ribbon arm that forms an oligomeric transmembrane barrel
  4. 3022604Superfamily f.6.1: Leukocidin-like [56959] (3 families) (S)
  5. 3022605Family f.6.1.1: Leukocidin (pore-forming toxin) [56960] (5 proteins)
    heptameric fold contains barrel (n=14, S=14) formed by beta-ribbon arms, one from each subunit
    automatically mapped to Pfam PF07968
  6. 3022688Protein automated matches [190904] (4 species)
    not a true protein
  7. 3022691Species Staphylococcus aureus [TaxId:158878] [189747] (5 PDB entries)
  8. 3022724Domain d3anzu1: 3anz U:1-293 [172273]
    Other proteins in same PDB: d3anza2, d3anzb2, d3anzc2, d3anzd2, d3anze2, d3anzf2, d3anzg2, d3anzh2, d3anzi2, d3anzj2, d3anzk2, d3anzl2, d3anzm2, d3anzn2, d3anzo2, d3anzp2, d3anzq2, d3anzr2, d3anzs2, d3anzt2, d3anzu2, d3anzv2, d3anzw2, d3anzx2, d3anzy2, d3anzz2
    automated match to d7ahla_
    complexed with acy, mpd

Details for d3anzu1

PDB Entry: 3anz (more details), 2.3 Å

PDB Description: crystal structure of alpha-hemolysin
PDB Compounds: (U:) alpha-hemolysin

SCOPe Domain Sequences for d3anzu1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3anzu1 f.6.1.1 (U:1-293) automated matches {Staphylococcus aureus [TaxId: 158878]}
adsdiniktgttdigsnttvktgdlvtydkengmhkkvfysfiddknhnkkllvirtkgt
iagqyrvyseeganksglawpsafkvqlqlpdnevaqisdyyprnsidtkeymstltygf
ngnvtgddtgkiggliganvsightlkyvqpdfktilesptdkkvgwkvifnnmvnqnwg
pydrdswnpvygnqlfmktrngsmkaaenfldpnkassllssgfspdfatvitmdrkask
qqtnidviyervrddyqlhwtstnwkgtntkdkwtdrsserykidwekeemtn

SCOPe Domain Coordinates for d3anzu1:

Click to download the PDB-style file with coordinates for d3anzu1.
(The format of our PDB-style files is described here.)

Timeline for d3anzu1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3anzu2
View in 3D
Domains from other chains:
(mouse over for more information)
d3anza1, d3anza2, d3anzb1, d3anzb2, d3anzc1, d3anzc2, d3anzd1, d3anzd2, d3anze1, d3anze2, d3anzf1, d3anzf2, d3anzg1, d3anzg2, d3anzh1, d3anzh2, d3anzi1, d3anzi2, d3anzj1, d3anzj2, d3anzk1, d3anzk2, d3anzl1, d3anzl2, d3anzm1, d3anzm2, d3anzn1, d3anzn2, d3anzo1, d3anzo2, d3anzp1, d3anzp2, d3anzq1, d3anzq2, d3anzr1, d3anzr2, d3anzs1, d3anzs2, d3anzt1, d3anzt2, d3anzv1, d3anzv2, d3anzw1, d3anzw2, d3anzx1, d3anzx2, d3anzy1, d3anzy2, d3anzz1, d3anzz2