Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.6: Leukocidin-like [56958] (1 superfamily) subunit fold contains beta-sandwich of Ig-like (greek-key) topology and a beta-ribbon arm that forms an oligomeric transmembrane barrel |
Superfamily f.6.1: Leukocidin-like [56959] (3 families) |
Family f.6.1.1: Leukocidin (pore-forming toxin) [56960] (5 proteins) heptameric fold contains barrel (n=14, S=14) formed by beta-ribbon arms, one from each subunit automatically mapped to Pfam PF07968 |
Protein automated matches [190904] (4 species) not a true protein |
Species Staphylococcus aureus [TaxId:158878] [189747] (5 PDB entries) |
Domain d3anzl1: 3anz L:1-293 [172264] Other proteins in same PDB: d3anza2, d3anzb2, d3anzc2, d3anzd2, d3anze2, d3anzf2, d3anzg2, d3anzh2, d3anzi2, d3anzj2, d3anzk2, d3anzl2, d3anzm2, d3anzn2, d3anzo2, d3anzp2, d3anzq2, d3anzr2, d3anzs2, d3anzt2, d3anzu2, d3anzv2, d3anzw2, d3anzx2, d3anzy2, d3anzz2 automated match to d7ahla_ complexed with acy, mpd |
PDB Entry: 3anz (more details), 2.3 Å
SCOPe Domain Sequences for d3anzl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3anzl1 f.6.1.1 (L:1-293) automated matches {Staphylococcus aureus [TaxId: 158878]} adsdiniktgttdigsnttvktgdlvtydkengmhkkvfysfiddknhnkkllvirtkgt iagqyrvyseeganksglawpsafkvqlqlpdnevaqisdyyprnsidtkeymstltygf ngnvtgddtgkiggliganvsightlkyvqpdfktilesptdkkvgwkvifnnmvnqnwg pydrdswnpvygnqlfmktrngsmkaaenfldpnkassllssgfspdfatvitmdrkask qqtnidviyervrddyqlhwtstnwkgtntkdkwtdrsserykidwekeemtn
Timeline for d3anzl1:
View in 3D Domains from other chains: (mouse over for more information) d3anza1, d3anza2, d3anzb1, d3anzb2, d3anzc1, d3anzc2, d3anzd1, d3anzd2, d3anze1, d3anze2, d3anzf1, d3anzf2, d3anzg1, d3anzg2, d3anzh1, d3anzh2, d3anzi1, d3anzi2, d3anzj1, d3anzj2, d3anzk1, d3anzk2, d3anzm1, d3anzm2, d3anzn1, d3anzn2, d3anzo1, d3anzo2, d3anzp1, d3anzp2, d3anzq1, d3anzq2, d3anzr1, d3anzr2, d3anzs1, d3anzs2, d3anzt1, d3anzt2, d3anzu1, d3anzu2, d3anzv1, d3anzv2, d3anzw1, d3anzw2, d3anzx1, d3anzx2, d3anzy1, d3anzy2, d3anzz1, d3anzz2 |