| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
| Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
| Protein Troponin C [47503] (6 species) |
| Species Chicken (Gallus gallus) [TaxId:9031] [47504] (28 PDB entries) Uniprot P09860 |
| Domain d1avsa_: 1avs A: [17226] calcium-saturated N-terminal domain complexed with ca fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 1avs (more details), 1.75 Å
SCOPe Domain Sequences for d1avsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}
qaearaflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeeldaiieevd
edgsgtidfeeflvmmvrqmk
Timeline for d1avsa_: