SCOPe 2.05: Domain d3anxb_: 3anx B:

Lineage for d3anxb_ (3anx B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families)

5. Family c.66.1.17: Spermidine synthase [69557] (3 proteins)
   contains additional N-terminal tetramerisation all-beta domain, res. 1-71

6. Protein automated matches [190432] (5 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [189902] (1 PDB entry)

8. Domain d3anxb_: 3anx B: [172252]
   automated match to d1uirb_
   complexed with mta

Details for d3anxb_

PDB Entry: 3anx, 2.5 Å

PDB Description: Crystal structure of triamine/agmatine aminopropyltransferase (SPEE) from thermus thermophilus, complexed with MTA

PDB Compounds: (B:) spermidine synthase

SCOPe Domain Sequences for d3anxb_:

Sequence; same for both SEQRES and ATOM records:

>d3anxb_ c.66.1.17 (B:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mdygmyffehvtpyetlvrrmerviasgktpfqdyflfeskgfgkvlildkdvqsterde
yiyhetlvhpamlthpepkrvlivgggegatlrevlkhptvekavmvdidgelvevakrh
mpewhqgafddpravlviddaraylerteerydvviidltdpvgednparllytvefyrl
vkahlnpggvmgmqagmillthhrvhpvvhrtvreafryvrsyknhipgfflnfgfllas
dafdpaafsegviearirernlalrhltapyleamfvlpkdllealeketmvstdqnpfy
vtpegearqapyk

Timeline for d3anxb_:

• d3anxb_ first appeared in SCOPe 2.01
  
• d3anxb_ appears in SCOPe 2.04
  
• d3anxb_ appears in SCOPe 2.06
  
• d3anxb_ appears in the current release, SCOPe 2.08