Lineage for d3amfb_ (3amf B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 952712Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 952713Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 952714Family b.45.1.1: PNP-oxidase like [50476] (17 proteins)
  6. 952721Protein FMN-binding protein [50477] (1 species)
  7. 952722Species Desulfovibrio vulgaris, strain Miyazaki F [TaxId:881] [50478] (9 PDB entries)
  8. 952738Domain d3amfb_: 3amf B: [172247]
    automated match to d1axja_
    complexed with cl, fmn; mutant

Details for d3amfb_

PDB Entry: 3amf (more details), 1.6 Å

PDB Description: E13R mutant of FMN-binding protein from Desulfovibrio vulgaris (Miyazaki F)
PDB Compounds: (B:) fmn-binding protein

SCOPe Domain Sequences for d3amfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3amfb_ b.45.1.1 (B:) FMN-binding protein {Desulfovibrio vulgaris, strain Miyazaki F [TaxId: 881]}
mlpgtffevlknrgvvaiatqgedgphlvntwnsylkvldgnrivvpvggmhkteanvar
dervlmtlgsrkvagrngpgtgflirgsaafrtdgpefeaiarfkwaraalvitvvsaeq
tl

SCOPe Domain Coordinates for d3amfb_:

Click to download the PDB-style file with coordinates for d3amfb_.
(The format of our PDB-style files is described here.)

Timeline for d3amfb_: